CNOT1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA046577

 

Antibody HPA049664

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA046577 HPA049664 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

95 91 

Antigen sequence

TIETLMRINAHSRGNAPEGLPQLMEVVRSNYEAMIDRAHGGPNFMMHSGI
SQASEYDDPPGLREKAEYLLREWVNLYHSAAAGRDSTKAFSAFVG
 
ALLQINTSWHTLRHELISTLMPIFLGNHPNSAIILHYAWHGQGQSPSIRQ
LIMHAMAEWYMRGEQYDQAKLSRILDVAQDLKALSMLLNGT
 

Matching transcripts

CNOT1-001 - ENSP00000320949 [100%]
CNOT1-003 - ENSP00000455635 [100%]
CNOT1-005 - ENSP00000456649 [100%]
CNOT1-019 - ENSP00000454611 [100%]
CNOT1-201 - ENSP00000245138 [100%]
 CNOT1-001 - ENSP00000320949 [100%]
CNOT1-002 - ENSP00000413113 [100%]
CNOT1-003 - ENSP00000455635 [100%]
CNOT1-005 - ENSP00000456649 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidual cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:250 1:20 

Validation IH

Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data Uncertain: Two (or more) antibodies yielding similar or partly similar staining patterns and there is no available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

266.9, 266.4, 241.3, 139.7, 49.8 266.9, 266.4, 241.3, 173.8 

Antibody dilution

1:1140 1:180 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:9150 1:1400 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CNOT1-001
 
CNOT1-002
 
CNOT1-003
 
CNOT1-005
 
CNOT1-019
 
CNOT1-201