ABCC4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002476

 

Antibody CAB002751

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Chemicon
 

Product name

HPA002476 MAB4122 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

5 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

142  

Antigen sequence

NFSVGQRQLVCLARAILRKNQILIIDEATANVDPRTDELIQKKIREKFAH
CTVLTIAHRLNTIIDSDKIMVLDSGRLKEYDEPYVLLQNKESLFYKMVQQ
LGKAEAAALTETAKQVYFKRNYPHIGHTDHMVTNTSNGQPST
 
 

Matching transcripts

ABCC4-001 - ENSP00000366084 [100%]
ABCC4-201 - ENSP00000388657 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human prostate shows cytoplasmic and membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:20 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleoli & cytoplasm.
More information
  

Antibody dilution

1:45  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

149.5, 144.2 149.5, 144.2, 96.8, 88.1, 2.8 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ABCC4-001
 
ABCC4-201