AMELX

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA005988

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA005988 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

150 

Antigen sequence

VLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHH
IPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQP
QPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDK
 

Matching transcripts

AMELX-001 - ENSP00000370090 [100%]
AMELX-002 - ENSP00000370088 [100%]
AMELX-201 - ENSP00000335312 [100%]
 

Other gene match

AMELY - ENSG00000099721 [86%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in parietal cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:25 

Validation IH

Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data for all of the genes 

         Western Blot

Image

 

Description

 

Target mass (kDa)

23.2, 23.1, 21.7, 21.6, 19.8 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AMELX-001
 
AMELX-002
 
AMELX-201