GRK4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028737

 

Antibody HPA057023

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028737 HPA057023 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

122 60 

Antigen sequence

DKQPIGRRLFRQFCDTKPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILD
RFFNDKLAAPLPEIPPDVVTECRLGLKEENPSKKVFEECTRVAHNYLRGE
PFEEYQESSYFSQFLQWKWLER
 
ESGCFKDINKSESEEALPLDLDKNIHTPVSRPNRGFFYRLFRRGGCLTMV
PSEKEVEPKQ
 

Matching transcripts

GRK4-001 - ENSP00000381129 [99%]
GRK4-002 - ENSP00000381128 [99%]
GRK4-005 - ENSP00000264764 [99%]
GRK4-012 - ENSP00000427445 [99%]
 GRK4-001 - ENSP00000381129 [100%]
GRK4-005 - ENSP00000264764 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Application not done for this antibody. 

Antibody dilution

1:50  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

66.6, 63.0, 61.2, 57.7 66.6, 63.0 

Antibody dilution

1:250 1:190 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:2250 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferous ducts.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:300 

Literature conformity

 Partly consistent with gene/protein characterization data 

RNA consistency

 Mainly not consistent with RNAseq data 
 

ANTIGEN VIEW

? »
 
 
 
GRK4-001
 
GRK4-002
 
GRK4-005
 
GRK4-012