C3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003563

 

Antibody HPA020432

 

Antibody CAB004209

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003563 HPA020432 sc-28294 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 5 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

143 143  

Antigen sequence

QRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQLPSRSSKIT
HRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTC
NKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATMS
 
KVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVIVPLKTGLQEV
EVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHL
 
 

Matching transcripts

C3-001 - ENSP00000245907 [100%]
 C3-001 - ENSP00000245907 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human small intestine shows distinct positivity in plasma.
More information
 Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human lung shows distinct positivity in plasma.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:400 1:16000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
   

Target mass (kDa)

187.1 187.1 187.1, 21.7, 11.6, 11.2 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  

         Immunofluorescence

Image

   

Description

 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
  

Antibody dilution

 1:200  

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available.  
 

ANTIGEN VIEW

? »
 
 
 
C3-001