SYMPK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041756

 

Antibody HPA055661

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041756 HPA055661 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 86 

Antigen sequence

PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVY
TEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA
 
VKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTL
SPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWE
 

Matching transcripts

SYMPK-001 - ENSP00000245934 [100%]
 SYMPK-001 - ENSP00000245934 [100%]
SYMPK-006 - ENSP00000473136 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:550  

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:61 

Validation IF

Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

141.1 141.1, 74.5 

Antibody dilution

1:250 1:200 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:12000 1:2450 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SYMPK-001
 
SYMPK-006