ARMCX5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000996

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000996 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

118 

Antigen sequence

QAKAGDGAMTRTHTVTYREAMAVTREVIKVEDTTKTRVMVETKTKPLAER
SIVPQTKSKAMPMSRVSTVTKSEVKVVAVIEANIRSYAKSHDKANTGSRP
DRREETSIGMKSSDEDEE
 

Matching transcripts

ARMCX5-004 - ENSP00000246174 [100%]
ARMCX5-005 - ENSP00000361827 [100%]
ARMCX5-013 - ENSP00000474720 [100%]
ARMCX5-201 - ENSP00000445851 [100%]
ARMCX5-202 - ENSP00000439001 [100%]
ARMCX5-203 - ENSP00000446385 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows distinct nuclear positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:50 

Literature conformity

No avaliable characterization data 

RNA consistency

Mainly consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:20 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

62.3 

Antibody dilution

1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
ARMCX5-004
 
ARMCX5-005
 
ARMCX5-013
 
ARMCX5-201
 
ARMCX5-202
 
ARMCX5-203