TMEM115

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA015497

 

Antibody CAB006319

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abnova
 

Product name

HPA015497 H00011070-M01 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

90  

Antigen sequence

KTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIW
PSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITF
 
 

Matching transcripts

TMEM115-001 - ENSP00000266025 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:20 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in golgi apparatus & cytoskeleton (microtubules).
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in golgi apparatus.
More information
 

Antibody dilution

1:14 1:50 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416237)
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

38.2 38.2 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
TMEM115-001