ST3GAL3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051102

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051102 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

71 

Antigen sequence

KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKY
ANFSEGACKPGYASALMTAIF
 

Matching transcripts

ST3GAL3-001 - ENSP00000355341 [100%]
ST3GAL3-003 - ENSP00000361444 [100%]
ST3GAL3-009 - ENSP00000361440 [100%]
ST3GAL3-012 - ENSP00000361437 [100%]
ST3GAL3-016 - ENSP00000437206 [100%]
ST3GAL3-018 - ENSP00000431700 [100%]
ST3GAL3-027 - ENSP00000432965 [100%]
ST3GAL3-028 - ENSP00000432071 [100%]
ST3GAL3-030 - ENSP00000435621 [100%]
ST3GAL3-032 - ENSP00000434686 [100%]
ST3GAL3-202 - ENSP00000333494 [100%]
ST3GAL3-205 - ENSP00000330463 [100%]
ST3GAL3-208 - ENSP00000361452 [100%]
ST3GAL3-006 - ENSP00000317192 [81%]
ST3GAL3-007 - ENSP00000355201 [81%]
ST3GAL3-209 - ENSP00000439634 [81%]
ST3GAL3-005 - ENSP00000361442 [80%]
ST3GAL3-008 - ENSP00000361441 [80%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:800 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line HeLa shows positivity in vesicles.
More information
 

Antibody dilution

1:88 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

43.8, 42.2, 38.7, 31.6, 22.6, 21.2, 20.9, 20.8, 19.0, 17.4, 16.8, 13.7, 13.0, 11.9 

Antibody dilution

1:440 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3550 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
ST3GAL3-001
 
ST3GAL3-003
 
ST3GAL3-005
 
ST3GAL3-006
 
ST3GAL3-007
 
ST3GAL3-008
 
ST3GAL3-009
 
ST3GAL3-012
 
ST3GAL3-016
 
ST3GAL3-018
 
ST3GAL3-027
 
ST3GAL3-028
 
ST3GAL3-030
 
ST3GAL3-032
 
ST3GAL3-202
 
ST3GAL3-205
 
ST3GAL3-208
 
ST3GAL3-209
 
 »