IRF3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004895

 

Antibody CAB013018

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA004895 51-3200 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

143  

Antigen sequence

VNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTW
KRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDT
NGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQ
 
 

Matching transcripts

IRF3-001 - ENSP00000366344 [100%]
IRF3-002 - ENSP00000471896 [100%]
IRF3-003 - ENSP00000470436 [100%]
IRF3-004 - ENSP00000469113 [100%]
IRF3-005 - ENSP00000471358 [100%]
IRF3-006 - ENSP00000310127 [100%]
IRF3-007 - ENSP00000470431 [100%]
IRF3-019 - ENSP00000470140 [100%]
IRF3-025 - ENSP00000473128 [100%]
IRF3-028 - ENSP00000472223 [100%]
IRF3-201 - ENSP00000366339 [100%]
IRF3-027 - ENSP00000473176 [83%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows moderate cytoplasmic positivity.
More information
 Immunohistochemical staining of human testis shows distinct granular cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:150 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
  

Antibody dilution

1:74  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

49.1, 47.2, 44.5, 36.3, 33.2, 31.8, 29.2, 21.1, 17.4 49.1, 47.2, 44.5, 36.3, 33.2, 31.8, 30.8, 29.2, 21.1, 17.4, 16.7, 14.0, 13.0, 12.3, 11.8, 11.5, 9.2, 7.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
IRF3-001
 
IRF3-002
 
IRF3-003
 
IRF3-004
 
IRF3-005
 
IRF3-006
 
IRF3-007
 
IRF3-019
 
IRF3-025
 
IRF3-027
 
IRF3-028
 
IRF3-201
 
 »