HNRNPH2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000914

 

Antibody HPA001359

 

Antibody HPA016884

 

Antibody CAB004436

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA000914 HPA001359 HPA016884 sc-46673 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

14 1 4 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

115 115 117  

Antigen sequence

DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYD
HSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGG
YGGQSSMSGYDQVLQ
 
DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYD
HSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGG
YGGQSSMSGYDQVLQ
 
FIYTREGRPSGEAFVELESEEEVKLALKKDRETMGHRYVEVFKSNSVEMD
WVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLP
VDFQGRSTGEAFVQFAS
 
 

Matching transcripts

HNRNPH2-001 - ENSP00000361927 [100%]
 HNRNPH2-001 - ENSP00000361927 [100%]
 HNRNPH2-001 - ENSP00000361927 [100%]
  

Other gene match

HNRNPH1 - ENSG00000169045 [97%]
 HNRNPH1 - ENSG00000169045 [97%]
 HNRNPH1 - ENSG00000169045 [97%]
HNRNPF - ENSG00000169813 [84%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Application not done for this antibody. Immunohistochemical staining of human duodenum shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows nuclear positivity in both glomeruli and renal tubules.
More information
 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

 1:100 1:40 1:200 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:50  1:11  

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  

         GFP

Image

    

Description

Immunofluorescent staining of transgenic HeLa cells show antibody staining in nucleus but excluded from the nucleoli and GFP expression in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of transgenic HeLa cells show antibody staining in nucleus but excluded from the nucleoli and GFP expression in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

1:40  1:5  

Validation IFGFP

Supportive: Antibody staining overlaps with GFP tagged protein  Supportive: Antibody staining overlaps with GFP tagged protein  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 17.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

51.2, 49.3, 49.2, 47.1, 19.8, 12.0 51.2, 49.3, 49.2, 47.1, 19.8, 12.0 51.2, 49.3, 49.2, 47.1, 45.7, 24.1, 18.7, 18.2 49.3 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000 1:1000 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
HNRNPH2-001