CANX

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA009433

 

Antibody HPA009696

 

Antibody CAB004738

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA009433 HPA009696 sc-46669 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

71 83  

Antigen sequence

DVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFD
RGTLSGWILSKAKKDDTDDEI
 
TSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEE
DGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRR
 
 

Matching transcripts

CANX-001 - ENSP00000247461 [100%]
CANX-002 - ENSP00000424063 [100%]
CANX-005 - ENSP00000391646 [100%]
CANX-006 - ENSP00000424745 [100%]
CANX-007 - ENSP00000425246 [100%]
CANX-009 - ENSP00000421813 [100%]
CANX-021 - ENSP00000424341 [100%]
CANX-201 - ENSP00000394817 [100%]
 CANX-001 - ENSP00000247461 [100%]
CANX-002 - ENSP00000424063 [100%]
CANX-005 - ENSP00000391646 [100%]
CANX-201 - ENSP00000394817 [100%]
CANX-202 - ENSP00000423588 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human cerebral cortex shows strong nuclear membrane and cytoplasmic positivity in neuronal cells and glial cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:550 1:225 1:2000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

71.5, 67.6, 18.7, 16.0, 14.8, 11.9 71.5, 67.6, 55.6 71.5, 67.6, 55.6, 35.2, 21.4, 18.7, 16.0, 15.2, 14.8, 11.9, 10.3, 8.6, 6.7, 3.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in endoplasmic reticulum.
More information
 Application not done for this antibody. 

Antibody dilution

1:30 1:20  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
CANX-001
 
CANX-002
 
CANX-005
 
CANX-006
 
CANX-007
 
CANX-009
 
CANX-021
 
CANX-201
 
CANX-202