ATP13A4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051932

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051932 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

49 

Antigen sequence

ATTWEMAFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFPFSS
 

Matching transcripts

ATP13A4-003 - ENSP00000339182 [100%]
ATP13A4-007 - ENSP00000376238 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human heart muscle shows distinct cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:40 

Literature conformity

No avaliable gene/protein characterization data 

RNA consistency

Mainly not consistent with RNA expression data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line MCF7 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:69 

Validation IF

Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

134.0, 132.0 

Antibody dilution

1:350 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2750 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ATP13A4-003
 
ATP13A4-007