SMARCA4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA048340

 

Antibody CAB004208

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA048340 sc-17796 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein 

Length (aa)

56  

Antigen sequence

WLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDES
KKQKKR
 
 

Matching transcripts

SMARCA4-001 - ENSP00000343896 [100%]
SMARCA4-002 - ENSP00000466963 [100%]
SMARCA4-003 - ENSP00000392837 [100%]
SMARCA4-007 - ENSP00000395654 [100%]
SMARCA4-004 - ENSP00000464778 [98%]
SMARCA4-005 - ENSP00000445036 [98%]
SMARCA4-006 - ENSP00000443848 [98%]
SMARCA4-018 - ENSP00000467200 [98%]
SMARCA4-202 - ENSP00000414727 [98%]
SMARCA4-203 - ENSP00000397783 [98%]
SMARCA4-201 - ENSP00000350720 [96%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:150 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 

Antibody dilution

1:7 1:37 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

188.1, 184.6, 181.7, 181.6, 181.3, 49.7, 15.7 188.1, 184.6, 181.7, 181.6, 181.3, 49.7, 15.7, 12.6 

Antibody dilution

1:80 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
SMARCA4-001
 
SMARCA4-002
 
SMARCA4-003
 
SMARCA4-004
 
SMARCA4-005
 
SMARCA4-006
 
SMARCA4-007
 
SMARCA4-018
 
SMARCA4-201
 
SMARCA4-202
 
SMARCA4-203
 
 »