RNF6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039343

 

Antibody HPA040048

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039343 HPA040048 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 7 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

75 76 

Antigen sequence

SGTVYHNSQRESRPVQQTTRRSVRRRGRTRVFLEQDRERERRGTAYTPFS
NSRLVSRITVEEGEESSRSSTAVRR
 
TLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELRQREGQRFGAAHV
WENGARSNVTVRNTNQRLEPIRLRST
 

Matching transcripts

RNF6-001 - ENSP00000342121 [100%]
RNF6-002 - ENSP00000370982 [100%]
RNF6-006 - ENSP00000371000 [100%]
 RNF6-001 - ENSP00000342121 [100%]
RNF6-002 - ENSP00000370982 [100%]
RNF6-006 - ENSP00000371000 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nuclear membrane.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nuclear membrane & vesicles.
More information
 

Antibody dilution

1:43 1:111 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416958)
More information
  

Target mass (kDa)

78.1 78.1 

Antibody dilution

1:125 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human bone marrow shows strong nuclear positivity in bone marrow poietic cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:75 

Validation IH

 Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 
 

ANTIGEN VIEW

? »
 
 
 
RNF6-001
 
RNF6-002
 
RNF6-006