AKAP9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA008548

 

Antibody HPA026109

 

Antibody CAB012909

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Zymed
 

Product name

HPA008548 HPA026109 36-0300 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

3 5 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

148 144  

Antigen sequence

EKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEII
INHNRAENVQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMV
EDKVSFENMTVGEESKQEQLILDHLPSVTKESSLRATQPSENDKLQKE
 
KLLEAISETSSQLEHAKVTQTELMRESFRQKQEATESLKCQEELRERLHE
ESRAREQLAVELSKAEGVIDGYADEKTLFERQIQEKTDIIDRLEQELLCA
SNRLQELEAEQQQIQEERELLSRQKEAMKAEAGPVEQQLLQETE
 
 

Matching transcripts

AKAP9-001 - ENSP00000348573 [100%]
AKAP9-201 - ENSP00000350813 [100%]
AKAP9-202 - ENSP00000351922 [100%]
 AKAP9-001 - ENSP00000348573 [100%]
AKAP9-201 - ENSP00000350813 [100%]
AKAP9-202 - ENSP00000351922 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
More information
 Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.
More information
 Immunohistochemical staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:400 1:20 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in golgi apparatus & centrosome.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in golgi apparatus.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in golgi apparatus.
More information
 

Antibody dilution

1:222 1:7 1:37 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Target too small/large to be analyzed with the present setup Target too small/large to be analyzed with the present setup Lane 1: Marker [kDa] 213, 118, 83, 50, 33, 26, 18
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

453.7, 453.0, 447.8 453.7, 453.0, 447.8 453.7, 453.0, 447.8, 204.0, 36.2, 36.1, 26.5 

Antibody dilution

  1:500 

Validation WB

  Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
AKAP9-001
 
AKAP9-201
 
AKAP9-202