HIP1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA013606

 

Antibody HPA017964

 

Antibody CAB015334

 

Antibody CAB016402

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Santa Cruz Biotechnology
 

Product name

HPA013606 HPA017964 sc-33601 sc-47754 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

4 4 4 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Not known 

Length (aa)

150 140   

Antigen sequence

NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNK
FDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKT
ESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
 
QVIQDALNQLEEPPLISCAGSADHLLSTVTSISSCIEQLEKSWSQYLACP
EDISGLLHSITLLAHLTSDAIAHGATTCLRAPPEPADSLTEACKQYGRET
LAYLASLEEEGSLENADSTAMRNCLSKIKAIGEELLPRGL
 
 
 

Matching transcripts

HIP1-001 - ENSP00000336747 [100%]
HIP1-002 - ENSP00000410300 [100%]
 HIP1-001 - ENSP00000336747 [100%]
HIP1-002 - ENSP00000410300 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic immunoreactivity as well as an accentuation of the luminal membranes in distal tubules. Cells in glomeruli were also strongly stained.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in glomeruli and blood vessels.
More information
 Immunohistochemical staining of human vulva/anal skin shows strong cytoplasmic positivity in squamous epithelial cells and endothelial cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:600 1:90 1:50 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in vesicles.
More information
  Immunofluorescent staining of human cell line U-251 MG shows positivity in vesicles.
More information
  

Antibody dilution

1:222  1:23  

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

116.2, 110.7 116.2, 110.7 116.2, 110.7, 16.9 116.2, 110.7, 16.9 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000 1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
HIP1-001
 
HIP1-002