PODXL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA002110

 

Antibody HPA045507

 

Antibody CAB016169

 

Antibody CAB062558

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 

Product name

HPA002110 HPA045507 sc-23903 AMAb90667 

Host species

Rabbit Rabbit Mouse Mouse 

Clonality

pAb pAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

4 10 4 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known Recombinant protein 

Length (aa)

138 142   

Antigen sequence

LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVL
NLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVV
VKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD
 
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKAT
TLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADT
TTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTST
 
 
 

Matching transcripts

PODXL-001 - ENSP00000319782 [100%]
PODXL-005 - ENSP00000367817 [100%]
PODXL-202 - ENSP00000440518 [100%]
PODXL-201 - ENSP00000442655 [87%]
 PODXL-001 - ENSP00000319782 [100%]
PODXL-003 - ENSP00000390152 [100%]
PODXL-005 - ENSP00000367817 [100%]
PODXL-201 - ENSP00000442655 [100%]
PODXL-202 - ENSP00000440518 [99%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows moderate membranous positivity in renal glomeruli.
More information
 Immunohistochemical staining of human kidney shows cytoplasmic positivity in glomeruli.
More information
  

Retrieval method

HIER pH6 HIER pH6 HIER pH6  

Antibody dilution

1:250 1:125 1:300  

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data  

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli, plasma membrane, vesicles & microtubule organizing center.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli & vesicles.
More information
   

Antibody dilution

1:87 1:7   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Non-supportive: The subcellular location is not consistent with literature.   

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401657)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

58.9, 58.6, 55.4, 55.3 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 58.9, 58.6, 55.4, 55.3, 32.7 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
   

Antibody dilution

1:3000 1:500   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
PODXL-001
 
PODXL-003
 
PODXL-005
 
PODXL-201
 
PODXL-202