COPB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA040166

 

Antibody HPA043954

 

Antibody CAB012338

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA040166 HPA043954 ab24359 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

101 102  

Antigen sequence

NKVTVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSI
FGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKK
T
 
VLVVNQTSDTLQNCTLELATLGDLKLVEKPSPLTLAPHDFANIKANVKVA
STENGIIFGNIVYDVSGAASDRNCVVLSDIHIDIMDYIQPATCTDAEFRQ
MW
 
 

Matching transcripts

COPB1-001 - ENSP00000249923 [100%]
COPB1-002 - ENSP00000397873 [100%]
 COPB1-001 - ENSP00000249923 [100%]
COPB1-002 - ENSP00000397873 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human adrenal gland shows strong cytoplasmic positivity in cortical cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:400 

Validation IH

  Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

   

Description

  Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

107.1 107.1 107.1, 55.5, 15.7, 15.1 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in vesicles.
More information
  

Antibody dilution

1:99 1:94  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:3000  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
COPB1-001
 
COPB1-002