RIPK3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA054606

 

Antibody HPA055087

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA054606 HPA055087 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 95 

Antigen sequence

GPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQ
QTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEA
 
EMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQ
EEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
 

Matching transcripts

RIPK3-001 - ENSP00000216274 [100%]
 RIPK3-001 - ENSP00000216274 [100%]
RIPK3-009 - ENSP00000451840 [100%]
 

Other gene match

 RP11-934B9.3 - ENSG00000258973 [99%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human thyroid gland shows moderate nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:1400 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: The multi-targeting antibody yielding a staining pattern partly consistent with limited gene/protein characterization data or there is no available gene/protein characterization data for all or at least one of the genes 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

56.9 56.9, 27.0, 17.6 

Antibody dilution

1:110 1:410 

Validation WB

Uncertain: No bands detected Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:900 1:3300 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
RIPK3-001
 
RIPK3-009