SEC14L1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021463

 

Antibody HPA028703

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021463 HPA028703 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

90 94 

Antigen sequence

AMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSS
KKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDD
 
SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDS
LGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG
 

Matching transcripts

SEC14L1-001 - ENSP00000390392 [99%]
SEC14L1-002 - ENSP00000406030 [99%]
SEC14L1-003 - ENSP00000389838 [99%]
SEC14L1-004 - ENSP00000466581 [99%]
SEC14L1-012 - ENSP00000376268 [99%]
SEC14L1-014 - ENSP00000408169 [99%]
SEC14L1-015 - ENSP00000464973 [99%]
SEC14L1-025 - ENSP00000467934 [99%]
SEC14L1-201 - ENSP00000394716 [99%]
SEC14L1-023 - ENSP00000467347 [98%]
 SEC14L1-001 - ENSP00000390392 [100%]
SEC14L1-002 - ENSP00000406030 [100%]
SEC14L1-003 - ENSP00000389838 [100%]
SEC14L1-004 - ENSP00000466581 [100%]
SEC14L1-012 - ENSP00000376268 [100%]
SEC14L1-014 - ENSP00000408169 [100%]
SEC14L1-025 - ENSP00000467934 [100%]
SEC14L1-201 - ENSP00000394716 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus duct and strong cytoplasmic positivity in Leydig cells.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:125 1:100 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

81.8, 81.2, 77.1, 51.4, 17.0 81.8, 81.2, 77.1 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

 1:20 

Validation IF

 Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
SEC14L1-001
 
SEC14L1-002
 
SEC14L1-003
 
SEC14L1-004
 
SEC14L1-012
 
SEC14L1-014
 
SEC14L1-015
 
SEC14L1-023
 
SEC14L1-025
 
SEC14L1-201