SGOL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035501

 

Antibody CAB011569

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 

Product name

HPA035501 ab21633 

Host species

Rabbit Rabbit 

Clonality

pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

99  

Antigen sequence

DFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKL
IQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSK
 
 

Matching transcripts

SGOL1-002 - ENSP00000410458 [100%]
SGOL1-009 - ENSP00000263753 [100%]
SGOL1-010 - ENSP00000414129 [100%]
SGOL1-202 - ENSP00000406880 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human testis shows strong nucleolar positivity in cells of seminiferus ducts.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:350 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

64.2, 60.1 64.2, 60.1, 35.3, 33.5, 31.3, 29.4, 24.6, 9.9 

Antibody dilution

1:250 1:500 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
  

Antibody dilution

1:149  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
SGOL1-002
 
SGOL1-009
 
SGOL1-010
 
SGOL1-202