APOC1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA051518

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA051518 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

50 

Antigen sequence

PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE
 

Matching transcripts

APOC1-001 - ENSP00000465356 [100%]
APOC1-002 - ENSP00000468029 [100%]
APOC1-003 - ENSP00000468276 [100%]
APOC1-201 - ENSP00000252491 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human colon shows positivity in plasma.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

9.3, 8.6 

Antibody dilution

1:120 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:950 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
APOC1-001
 
APOC1-002
 
APOC1-003
 
APOC1-201