DPP6

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050509

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA050509 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

81 

Antigen sequence

VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGT
PGSQSVAEKFEVSWETVMVSSHGAVVVKCDG
 

Matching transcripts

DPP6-001 - ENSP00000385578 [100%]
DPP6-003 - ENSP00000367001 [100%]
DPP6-006 - ENSP00000328226 [100%]
DPP6-007 - ENSP00000397303 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human cerebral cortex shows distinct positivity in neuropil.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:450 

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

97.6, 91.3, 91.2, 86.3 

Antibody dilution

1:180 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1450 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
DPP6-001
 
DPP6-003
 
DPP6-006
 
DPP6-007