ACSBG2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA043421

 

Antibody HPA051013

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA043421 HPA051013 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

77 93 

Antigen sequence

LKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQ
QGINAVNQEAMNNAQRIEKWVILEKDF
 
IYATNSAEACQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY
RLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVL
 

Matching transcripts

ACSBG2-001 - ENSP00000466336 [100%]
ACSBG2-002 - ENSP00000465589 [100%]
ACSBG2-003 - ENSP00000467755 [100%]
ACSBG2-007 - ENSP00000464938 [100%]
ACSBG2-201 - ENSP00000252669 [100%]
 ACSBG2-002 - ENSP00000465589 [99%]
ACSBG2-003 - ENSP00000467755 [99%]
ACSBG2-007 - ENSP00000464938 [99%]
ACSBG2-201 - ENSP00000252669 [99%]
ACSBG2-010 - ENSP00000465581 [98%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human testis shows strong cytoplasmic positivity in spermatids.
More information
 Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:500 1:80 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
  

Antibody dilution

1:200  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

74.4, 68.8, 53.5 74.4, 68.8, 13.1 

Antibody dilution

1:250 1:90 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:6000 1:700 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ACSBG2-001
 
ACSBG2-002
 
ACSBG2-003
 
ACSBG2-007
 
ACSBG2-010
 
ACSBG2-201