PNCK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007458

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007458 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

72 

Antigen sequence

MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKA
LRGKEALVENEIAVLRRISHPN
 

Matching transcripts

PNCK-001 - ENSP00000359169 [100%]
PNCK-002 - ENSP00000359161 [100%]
PNCK-004 - ENSP00000405950 [100%]
PNCK-005 - ENSP00000415770 [100%]
PNCK-006 - ENSP00000340586 [100%]
PNCK-013 - ENSP00000396128 [100%]
PNCK-014 - ENSP00000391772 [100%]
PNCK-022 - ENSP00000359164 [100%]
PNCK-201 - ENSP00000377417 [100%]
PNCK-015 - ENSP00000397085 [93%]
PNCK-016 - ENSP00000411267 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human hippocampus shows moderate cytopalsmic positivity in neuronal cells, glial cells showed moderate cytoplasmic and nuclear staining.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Literature conformity

Consistent with gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:10 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.0, 40.8, 40.4, 38.5, 25.0, 24.7, 11.1, 10.4, 9.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
PNCK-001
 
PNCK-002
 
PNCK-004
 
PNCK-005
 
PNCK-006
 
PNCK-013
 
PNCK-014
 
PNCK-015
 
PNCK-016
 
PNCK-022
 
PNCK-201
 
 »