PNCK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007458

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA007458 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

72 

Antigen sequence

MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKA
LRGKEALVENEIAVLRRISHPN
 

Matching transcripts

PNCK-001 - ENSP00000359169 [100%]
PNCK-002 - ENSP00000359161 [100%]
PNCK-004 - ENSP00000405950 [100%]
PNCK-005 - ENSP00000415770 [100%]
PNCK-006 - ENSP00000340586 [100%]
PNCK-013 - ENSP00000396128 [100%]
PNCK-014 - ENSP00000391772 [100%]
PNCK-022 - ENSP00000359164 [100%]
PNCK-201 - ENSP00000377417 [100%]
PNCK-015 - ENSP00000397085 [93%]
PNCK-016 - ENSP00000411267 [93%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human stomach shows strong nuclear and cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:35 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:10 

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

47.0, 40.8, 40.4, 38.5, 25.0, 24.7, 11.1, 10.4, 9.5 

Antibody dilution

1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 « 
 
PNCK-001
 
PNCK-002
 
PNCK-004
 
PNCK-005
 
PNCK-006
 
PNCK-013
 
PNCK-014
 
PNCK-015
 
PNCK-016
 
PNCK-022
 
PNCK-201
 
 »