AKAP12

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA006344

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA006344 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

106 

Antigen sequence

QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPES
FEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDS
ETDGST
 

Matching transcripts

AKAP12-001 - ENSP00000253332 [100%]
AKAP12-002 - ENSP00000346702 [100%]
AKAP12-201 - ENSP00000352794 [100%]
AKAP12-202 - ENSP00000384537 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human testis shows strong cytoplasmic and membranous positivity in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:75 

Validation IH

Uncertain: One antibody yielding a staining pattern and there is no available gene/protein characterization data or the staining pattern is partly consistent with or contradicted by limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

191.5, 181.7, 181.0 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AKAP12-001
 
AKAP12-002
 
AKAP12-201
 
AKAP12-202