ARHGEF9

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035419

 

Antibody HPA055291

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035419 HPA055291 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

75 53 

Antigen sequence

DEEGWFPASFVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRD
QMRANVINEIMSTERHYIKHLKDIC
 
VPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTP
FKK
 

Matching transcripts

ARHGEF9-001 - ENSP00000253401 [100%]
ARHGEF9-002 - ENSP00000364012 [100%]
ARHGEF9-004 - ENSP00000364006 [100%]
ARHGEF9-203 - ENSP00000399994 [85%]
 ARHGEF9-001 - ENSP00000253401 [100%]
ARHGEF9-004 - ENSP00000364006 [100%]
ARHGEF9-201 - ENSP00000364004 [100%]
ARHGEF9-202 - ENSP00000404478 [100%]
ARHGEF9-203 - ENSP00000399994 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:180  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Western Blot

Image

  

Description

 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.0, 58.7, 56.4, 55.0 61.0, 58.7, 55.0, 49.5, 28.7 

Antibody dilution

1:250 1:80 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         Immunofluorescence

Image

  

Description

Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
More information
 

Antibody dilution

 1:22 

Validation IF

 Supportive: The subcellular location is supported by literature. 
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF9-001
 
ARHGEF9-002
 
ARHGEF9-004
 
ARHGEF9-201
 
ARHGEF9-202
 
ARHGEF9-203