ABCB7

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA034982

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA034982 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

92 

Antigen sequence

GAMKDVVKHRTSIFIAHRLSTVVDADEIIVLDQGKVAERGTHHGLLANPH
SIYSEMWHTQSSRVQNHDNPKWEAKKENISKEEERKKLQEEI
 

Matching transcripts

ABCB7-001 - ENSP00000253577 [100%]
ABCB7-002 - ENSP00000362492 [100%]
ABCB7-006 - ENSP00000343849 [100%]
ABCB7-005 - ENSP00000436586 [87%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human lung shows strong membranous positivity in alveolar cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:200 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 

Antibody dilution

1:200 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

 

Target mass (kDa)

82.8, 82.6, 78.2, 77.1 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ABCB7-001
 
ABCB7-002
 
ABCB7-005
 
ABCB7-006