HAUS8

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA039406

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA039406 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

8 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

94 

Antigen sequence

ATRFKEQYRTFATALDTTRHELPVRSIHLEGDGQQLLDALQHELVTTQRL
LGELDVGDSEENVQVLDLLSELKDVTAKKDLELRRSFAQVLELS
 

Matching transcripts

HAUS8-001 - ENSP00000253669 [100%]
HAUS8-002 - ENSP00000470829 [100%]
HAUS8-004 - ENSP00000395298 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:600 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

44.9, 44.8, 38.5 

Antibody dilution

1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
HAUS8-001
 
HAUS8-002
 
HAUS8-004