NAPSA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA045280

 

Antibody HPA047236

 

Antibody HPA047744

 

Antibody CAB009591

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA045280 HPA047236 HPA047744 NCL-Napsin A 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

12 12 12 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

31 36 45  

Antigen sequence

SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG
 
DGILGLGFPILSVEGVRPPLDVLVEQGLLDKPVFSF
 
GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVF
 
 

Matching transcripts

NAPSA-001 - ENSP00000253719 [100%]
NAPSA-006 - ENSP00000469061 [100%]
 NAPSA-001 - ENSP00000253719 [97%]
NAPSA-006 - ENSP00000469061 [97%]
 NAPSA-001 - ENSP00000253719 [100%]
NAPSA-006 - ENSP00000469061 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.
More information
 Immunohistochemical staining of human lung shows strong cytoplasmic positivity in type 2 pneumocytes.
More information
 Immunohistochemical staining of human lung shows strong cytoplasmic positivity in granular pattern in type II pneumocytes.
More information
 Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:200 1:25 1:75 1:150 

Validation IH

Supportive: Two (or more) antibodies yielding partly similar staining patterns which are consistent with gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 111, 83, 48, 32, 26, 17
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

45.4, 29.1 45.4, 29.1 45.4, 29.1 45.4, 29.1, 11.4 

Antibody dilution

1:250 1:110 1:80 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected Uncertain: No bands detected 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000 1:900 1:650  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
NAPSA-001
 
NAPSA-006