ACLY

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA022434

 

Antibody HPA022953

 

Antibody HPA022959

 

Antibody HPA028758

 

Antibody CAB007783

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA022434 HPA022953 HPA022959 HPA028758 1699-1 

Host species

Rabbit Rabbit Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

5 5 5 6 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

97 98 101 90  

Antigen sequence

AEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDI
KKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGV
 
CANQASETAVAKNQALKEAGVFVPRSFDELGEIIQSVYEDLVANGVIVPA
QEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELIYAGMPITE
 
YICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIW
TMVAGGGASVVYSDTICDLGGVNELANYGEYSGAPSEQQTYDYAKTILSL
M
 
TTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLG
LVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPF
 
 

Matching transcripts

ACLY-001 - ENSP00000253792 [100%]
ACLY-002 - ENSP00000377474 [100%]
ACLY-003 - ENSP00000466259 [100%]
ACLY-201 - ENSP00000345398 [100%]
 ACLY-001 - ENSP00000253792 [100%]
ACLY-002 - ENSP00000377474 [100%]
ACLY-003 - ENSP00000466259 [100%]
ACLY-004 - ENSP00000445349 [100%]
ACLY-201 - ENSP00000345398 [100%]
 ACLY-001 - ENSP00000253792 [100%]
ACLY-002 - ENSP00000377474 [100%]
ACLY-003 - ENSP00000466259 [100%]
ACLY-201 - ENSP00000345398 [100%]
 ACLY-001 - ENSP00000253792 [100%]
ACLY-002 - ENSP00000377474 [100%]
ACLY-003 - ENSP00000466259 [100%]
ACLY-201 - ENSP00000345398 [100%]
ACLY-005 - ENSP00000468705 [99%]
ACLY-004 - ENSP00000445349 [82%]
  

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human prostate shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic and nuclear positivity in islet cells.
More information
 Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human kidney shows distinct nuclear and cytoplasmic positivity in cells in tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:75 1:35 1:90 1:20 1:200 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli & cytoplasm.
More information
 

Antibody dilution

1:10 1:10 1:20 1:20 1:50 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

120.8, 119.8 120.8, 119.8, 91.1 120.8, 119.8 120.8, 119.8, 91.1, 12.3 120.8, 119.8, 91.1, 14.2, 12.3 

Antibody dilution

1:250 1:250 1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500 1:500 1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACLY-001
 
ACLY-002
 
ACLY-003
 
ACLY-004
 
ACLY-005
 
ACLY-201