G6PC

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA052324

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA052324 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

32 

Antigen sequence

MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFIL
 

Matching transcripts

G6PC-001 - ENSP00000253801 [100%]
G6PC-002 - ENSP00000465958 [100%]
G6PC-003 - ENSP00000466202 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:100 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Mainly not consistent with RNAseq data 

         Western Blot

Image

 

Description

 

Target mass (kDa)

40.5, 20.2, 19.0 

Antibody dilution

1:250 

Validation WB

Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
G6PC-001
 
G6PC-002
 
G6PC-003