MCCC2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA038300

 

Antibody HPA038301

 

Antibody HPA061546

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA038300 HPA038301 HPA061546 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

13 7 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

86 77 80 

Antigen sequence

GIAKDGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWP
NARISVMGGEQAANVLATITKDQRAREGKQFSSADE
 
LHISRGKLLPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGIITGI
GRVSGVECMIIANDATVKGGAYYPVTV
 
LPCIYLVDSGGAYLPRQADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMG
SCTAGGAYVPAMADENIIVRKQGTIFLAGP
 

Matching transcripts

MCCC2-001 - ENSP00000343657 [100%]
MCCC2-009 - ENSP00000425474 [100%]
MCCC2-201 - ENSP00000327308 [100%]
 MCCC2-001 - ENSP00000343657 [100%]
MCCC2-002 - ENSP00000423202 [100%]
MCCC2-003 - ENSP00000420994 [100%]
MCCC2-201 - ENSP00000327308 [100%]
 MCCC2-001 - ENSP00000343657 [100%]
MCCC2-003 - ENSP00000420994 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:1000 1:250 1:1000 

Literature conformity

Consistent with gene/protein characterization data Consistent with gene/protein characterization data Consistent with gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:105   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

61.3, 57.5, 31.6 61.3, 57.5, 39.7, 36.3 61.3, 39.7 

Antibody dilution

1:250 1:250 1:320 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:3850 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MCCC2-001
 
MCCC2-002
 
MCCC2-003
 
MCCC2-009
 
MCCC2-201