ACACA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA036650

 

Antibody HPA063018

 

Antibody CAB013715

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 SDIX
 

Product name

HPA036650 HPA063018 2098.00.02 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb msAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity 

Released in version

13 13 4 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Genetic immunization 

Length (aa)

62 62  

Antigen sequence

MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLS
PASVGSDTLSDL
 
MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLS
PASVGSDTLSDL
 
 

Matching transcripts

ACACA-001 - ENSP00000344789 [100%]
ACACA-004 - ENSP00000397282 [100%]
ACACA-007 - ENSP00000391001 [100%]
ACACA-009 - ENSP00000377928 [100%]
ACACA-010 - ENSP00000390132 [100%]
ACACA-019 - ENSP00000464991 [100%]
ACACA-202 - ENSP00000399445 [100%]
 ACACA-001 - ENSP00000344789 [100%]
ACACA-004 - ENSP00000397282 [100%]
ACACA-007 - ENSP00000391001 [100%]
ACACA-009 - ENSP00000377928 [100%]
ACACA-010 - ENSP00000390132 [100%]
ACACA-019 - ENSP00000464991 [100%]
ACACA-202 - ENSP00000399445 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human testis shows strong positivity in Leydig cells.
More information
 Immunohistochemical staining of human testis shows strong positivity in Leydig cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:20 1:350 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNAseq data Mainly consistent with RNAseq data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

270.0, 265.6, 13.1, 12.7, 12.1, 9.0, 8.3 270.0, 265.6, 13.1, 12.7, 12.1, 9.0, 8.3 270.0, 265.6, 259.7, 257.2, 114.6, 54.1, 26.7, 13.1, 12.7, 12.1, 10.8, 10.6, 9.0, 8.3, 6.2, 4.7 

Antibody dilution

1:250 1:80 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleoli, cytoplasm & actin filaments.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:72   

Validation IF

Supportive: The subcellular location is supported by literature.   

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ACACA-001
 
ACACA-004
 
ACACA-007
 
ACACA-009
 
ACACA-010
 
ACACA-019
 
ACACA-202