PRKAA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035409

 

Antibody HPA064946

 

Antibody CAB005050

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA035409 HPA064946 1596-1 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

14 14 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Native protein 

Length (aa)

60 60  

Antigen sequence

NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQ
KSKHQGVRKA
 
NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQ
KSKHQGVRKA
 
 

Matching transcripts

PRKAA1-001 - ENSP00000346148 [100%]
PRKAA1-002 - ENSP00000380317 [100%]
 PRKAA1-001 - ENSP00000346148 [100%]
PRKAA1-002 - ENSP00000380317 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Application not done for this antibody. Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 

Antibody dilution

 1:650 1:25 

Literature conformity

 Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

 Mainly consistent with RNA expression data Mainly consistent with RNA expression data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:6   

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

65.5, 64.0 65.5, 64.0 65.5, 64.0, 23.6 

Antibody dilution

1:250 1:340 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:500 1:4150  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKAA1-001
 
PRKAA1-002