PRKAA1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035409

 

Antibody CAB005050

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Epitomics
 

Product name

HPA035409 1596-1 

Host species

Rabbit Rabbit 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

12 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

60  

Antigen sequence

NEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQ
KSKHQGVRKA
 
 

Matching transcripts

PRKAA1-001 - ENSP00000346148 [100%]
PRKAA1-002 - ENSP00000380317 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

 Immunohistochemical staining of human small intestine shows distinct cytoplasmic positivity in glandular cells.
More information
 

Retrieval method

 HIER pH6 

Antibody dilution

 1:25 

Validation IH

 Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

65.5, 64.0 65.5, 64.0, 23.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
  

Antibody dilution

1:6  

Validation IF

Supportive: The subcellular location is supported by literature.  

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PRKAA1-001
 
PRKAA1-002