NES

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA007007

 

Antibody HPA026111

 

Antibody CAB005889

 

Antibody CAB058692

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Abcam plc
 Atlas Antibodies
 

Product name

HPA007007 HPA026111 ab5968 AMAb90556 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb msAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity Protein A/G 

Released in version

4 5 3 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Synthetic peptide Recombinant protein 

Length (aa)

119 144   

Antigen sequence

DPEGQSQQVGAPGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPA
MGESAAGAEPGPGQGVGGLGDPGHLTREEVMEPPLEEESLEAKRVQGLEG
PRKDLEEAGGLGTEFSELP
 
EPLRSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSL
EEQDQETLRTLEKETQQRRRSLGEQDQMTLRPPEKVDLEPLKSLDQEIAR
PLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETLK
 
 
 

Matching transcripts

NES-001 - ENSP00000357206 [100%]
 NES-001 - ENSP00000357206 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human kidney shows distinct positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in glomeruli and endothlial cells.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:250 1:3000 1:1000 1:3500 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in intermediate filaments.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in intermediate filaments.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in intermediate filaments.
More information
 Application not done for this antibody. 

Antibody dilution

1:35 1:200 1:200  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 229, 112, 83.5, 47.9, 32.3, 26.5, 17.2
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

177.4 177.4 177.4 177.4 

Antibody dilution

1:250 1:250 1:500 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:3000   

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.   
 

ANTIGEN VIEW

? »
 
 
 
NES-001