MORC4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000395

 

Antibody HPA015547

 

Antibody HPA050250

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000395 HPA015547 HPA050250 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 12 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

125 121 121 

Antigen sequence

PRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKGVRDSGAPIQLIPFNRE
ELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQ
RELEELKRTTEKLERVLAERNLFQQ
 
SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPA
PYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSI
LYPGAKDQRQGSLLPEELEDQ
 
SPSLQLKPLDSSVLQFSSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPA
PYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYPEASKNTGQNREVSI
LYPGAKDQRQGSLLPEELEDQ
 

Matching transcripts

MORC4-001 - ENSP00000347821 [100%]
MORC4-003 - ENSP00000255495 [100%]
MORC4-201 - ENSP00000440359 [100%]
 MORC4-001 - ENSP00000347821 [100%]
MORC4-003 - ENSP00000255495 [100%]
MORC4-201 - ENSP00000440359 [100%]
 MORC4-001 - ENSP00000347821 [100%]
MORC4-003 - ENSP00000255495 [100%]
MORC4-201 - ENSP00000440359 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.
More information
 Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
More information
  

Retrieval method

HIER pH6 HIER pH6  

Antibody dilution

1:35 1:75  

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

106.3, 101.9, 74.4 106.3, 101.9, 74.4 106.3, 101.9, 74.4 

Antibody dilution

1:250 1:250 1:80 

Validation WB

Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 

         Immunofluorescence

Image

   

Description

  Immunofluorescent staining of human cell line A-549 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

  1:7 

Validation IF

  Uncertain: The subcellular location is partly supported by literature or no literature is available. 
 

ANTIGEN VIEW

? »
 
 
 
MORC4-001
 
MORC4-003
 
MORC4-201