SRRM1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA049941

 

Antibody HPA058612

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA049941 HPA058612 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

10 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

61 52 

Antigen sequence

RQRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATSTSDILKVPKPE
PIPEPKEPSPE
 
IAAATTTLAQEEPVAAPEPKKETESEAEDNLDDLEKHLREKALRSMRKAQ
VS
 

Matching transcripts

SRRM1-001 - ENSP00000326261 [98%]
SRRM1-002 - ENSP00000363510 [98%]
SRRM1-022 - ENSP00000471084 [98%]
SRRM1-201 - ENSP00000391430 [98%]
SRRM1-202 - ENSP00000441776 [97%]
 SRRM1-001 - ENSP00000326261 [100%]
SRRM1-002 - ENSP00000363510 [100%]
SRRM1-201 - ENSP00000391430 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
More information
  

Retrieval method

HIER pH6  

Antibody dilution

1:100  

Validation IH

Supportive: One antibody yielding a staining pattern which is consistent with gene/protein characterization data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line HEK 293 shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:97 1:200 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

103.8, 103.4, 102.3, 78.1, 36.7 103.8, 103.4, 102.3 

Antibody dilution

1:100 1:1050 

Validation WB

Uncertain: No bands detected Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3900 1:12550 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SRRM1-001
 
SRRM1-002
 
SRRM1-022
 
SRRM1-201
 
SRRM1-202