MYH11

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA014539

 

Antibody HPA015310

 

Antibody CAB002302

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Novocastra
 

Product name

HPA014539 HPA015310 NCL-MHC-Sm 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

4 4 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

88 97  

Antigen sequence

LQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQL
SDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEK
 
VTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKN
KQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGE
 
 

Matching transcripts

MYH11-001 - ENSP00000300036 [100%]
MYH11-003 - ENSP00000458731 [100%]
MYH11-006 - ENSP00000379616 [100%]
MYH11-013 - ENSP00000407821 [100%]
MYH11-201 - ENSP00000483524 [100%]
MYH11-202 - ENSP00000484924 [100%]
 MYH11-001 - ENSP00000300036 [100%]
MYH11-003 - ENSP00000458731 [100%]
MYH11-006 - ENSP00000379616 [100%]
MYH11-013 - ENSP00000407821 [100%]
MYH11-201 - ENSP00000483524 [100%]
MYH11-202 - ENSP00000484924 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human breast shows moderate positivity in myoepithelial cells.
More information
 Immunohistochemical staining of human breast shows strong positivity in myoepithelial cells.
More information
 Immunohistochemical staining of human rectum shows distinct positivity in smooth muscle of vessels.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:125 1:100 1:50 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done 

         Immunofluorescence

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

 1:34 1:13 

Validation IF

 Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. Uncertain: The subcellular location is partly supported by experimental gene/protein characterization data, or no such data is available. 

         GFP

Image

   

Description

Application not done for this antibody. Immunofluorescent staining of transgenic HeLa cells show antibody staining in plasma membrane & cytoplasm and GFP expression in plasma membrane & cytoplasm.
More information
 Application not done for this antibody. 

Antibody dilution

 1:35  

Validation IFGFP

 Supportive: Antibody staining overlaps with GFP tagged protein  

         Western Blot

Image

   

Description

 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

234.2, 228.1, 227.3, 224.3, 223.6 234.2, 228.1, 227.3, 224.3, 223.6 234.2, 228.1, 227.3, 224.3, 223.6 

Antibody dilution

1:250 1:250 1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MYH11-001
 
MYH11-003
 
MYH11-006
 
MYH11-013
 
MYH11-201
 
MYH11-202