ARNTL

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA050938

 

Antibody HPA054172

 

Antibody CAB045962

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Origene
 

Product name

HPA050938 HPA054172 TA501174 

Host species

Rabbit Rabbit Mouse 

Clonality

pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

12 12 11 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

79 70  

Antigen sequence

SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSD
SSSILGENPHIGIDMIDNDQGSSSPSNDE
 
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESM
DTDKDDPHGRLEYTEHQGRI
 
 

Matching transcripts

ARNTL-001 - ENSP00000374357 [100%]
ARNTL-002 - ENSP00000385581 [100%]
ARNTL-003 - ENSP00000385915 [100%]
ARNTL-004 - ENSP00000384517 [100%]
ARNTL-005 - ENSP00000385897 [100%]
ARNTL-201 - ENSP00000354278 [100%]
ARNTL-203 - ENSP00000379718 [100%]
 ARNTL-001 - ENSP00000374357 [100%]
ARNTL-004 - ENSP00000384517 [100%]
ARNTL-019 - ENSP00000433540 [100%]
ARNTL-020 - ENSP00000431488 [100%]
ARNTL-022 - ENSP00000433571 [100%]
ARNTL-201 - ENSP00000354278 [100%]
ARNTL-202 - ENSP00000374358 [100%]
ARNTL-203 - ENSP00000379718 [100%]
ARNTL-015 - ENSP00000431566 [84%]
ARNTL-011 - ENSP00000434781 [81%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

  Immunohistochemical staining of human stomach, upper shows moderate nuclear positivity in glandular cells.
More information
 

Retrieval method

  HIER pH6 

Antibody dilution

  1:300 

Validation IH

  Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

68.8, 68.7, 64.2, 64.1, 55.5 68.8, 68.7, 59.3, 55.5, 15.2, 11.4, 8.4, 6.7, 6.4 68.8, 68.7, 64.2, 64.1, 59.3, 55.5, 19.4, 16.2, 15.2, 11.4, 8.4, 6.7, 6.4, 5.6, 2.5 

Antibody dilution

1:250 1:110 1:500 

Validation WB

Uncertain: No bands detected Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus & vesicles.
More information
  

Antibody dilution

1:49 1:23  

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available. Uncertain: The subcellular location is partly supported by literature or no literature is available.  

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:1950 1:900  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
ARNTL-001
 
ARNTL-002
 
ARNTL-003
 
ARNTL-004
 
ARNTL-005
 
ARNTL-011
 
ARNTL-015
 
ARNTL-019
 
ARNTL-020
 
ARNTL-022
 
ARNTL-201
 
ARNTL-202
 
ARNTL-203
 
 »