HSD17B4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA021302

 

Antibody HPA021311

 

Antibody HPA021479

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA021302 HPA021311 HPA021479 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

5 5 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

87 74 126 

Antigen sequence

LRFDGRVVLVTGAGAGLGRAYALAFAERGALVVVNDLGGDFKGVGKGSLA
ADKVVEEIRRRGGKAVANYDSVEEGEKVVKTALDAFG
 
ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKIC
DFENASKPQSIQESTGSIIEVLSK
 
VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRI
IMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNA
GSRMTQTVMPEDLVEALKPEYVAPLV
 

Matching transcripts

HSD17B4-001 - ENSP00000256216 [100%]
HSD17B4-009 - ENSP00000390208 [100%]
 HSD17B4-001 - ENSP00000256216 [100%]
HSD17B4-002 - ENSP00000424613 [100%]
HSD17B4-003 - ENSP00000420914 [100%]
HSD17B4-004 - ENSP00000411960 [100%]
HSD17B4-005 - ENSP00000424940 [100%]
HSD17B4-007 - ENSP00000425993 [100%]
HSD17B4-009 - ENSP00000390208 [100%]
 HSD17B4-001 - ENSP00000256216 [100%]
HSD17B4-002 - ENSP00000424613 [100%]
HSD17B4-003 - ENSP00000420914 [100%]
HSD17B4-005 - ENSP00000424940 [100%]
HSD17B4-009 - ENSP00000390208 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:300 1:50 1:25 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
  

Antibody dilution

1:20 1:20  

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

79.7, 53.9 83.0, 79.7, 77.9, 77.6, 65.0, 64.6, 53.9 83.0, 79.7, 77.9, 77.6, 53.9 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HSD17B4-001
 
HSD17B4-002
 
HSD17B4-003
 
HSD17B4-004
 
HSD17B4-005
 
HSD17B4-007
 
HSD17B4-009