ELP3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA025812

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA025812 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

96 

Antigen sequence

ELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVE
HGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRR
 

Matching transcripts

ELP3-001 - ENSP00000256398 [100%]
ELP3-003 - ENSP00000429180 [100%]
ELP3-010 - ENSP00000428449 [100%]
ELP3-201 - ENSP00000369711 [100%]
ELP3-202 - ENSP00000445558 [100%]
ELP3-203 - ENSP00000439242 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:250 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

62.3, 60.6, 54.2, 52.2, 49.4, 48.1 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
ELP3-001
 
ELP3-003
 
ELP3-010
 
ELP3-201
 
ELP3-202
 
ELP3-203