MRPS36

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA035802

 

Antibody HPA056795

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA035802 HPA056795 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

55 49 

Antigen sequence

SSVISQHSKGSKSPDLLMYQGPPDTAEIIKTLPQKYRRKLVSQEEMEFIQ
RGGPE
 
MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
 

Matching transcripts

MRPS36-001 - ENSP00000256441 [100%]
 MRPS36-001 - ENSP00000256441 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong cytoplasmic positivity(granular pattern) in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:2500  

Literature conformity

Consistent with gene/protein characterization data  

RNA consistency

Mainly consistent with RNAseq data  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in mitochondria.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in mitochondria.
More information
 

Antibody dilution

1:200 1:30 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

11.5 11.5 

Antibody dilution

1:250 1:100 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:500 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 

         siRNA

Image

  

Description

Application not done for this antibody. Signal downregulation > 25% by one siRNA.
More information
 

Antibody dilution

 1:30 

Validation siRNA

 Supportive: The siRNA validation is supportive. 
 

ANTIGEN VIEW

? »
 
 
 
MRPS36-001