VAV3

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028138

 

Antibody CAB002012

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Upstate
 

Product name

HPA028138 07-464 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known 

Length (aa)

77  

Antigen sequence

AHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQ
AETELINRVNSTYLVRHRTKESGEYAI
 
 

Matching transcripts

VAV3-001 - ENSP00000359073 [100%]
VAV3-005 - ENSP00000394897 [100%]
VAV3-007 - ENSP00000432540 [100%]
VAV3-202 - ENSP00000446404 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human pancreas shows cytoplasmic and nuclear positivity in exocrine cells.
More information
 Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in granular pattern in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:10 1:200 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

100.8, 97.8, 32.6, 28.5 100.8, 97.8, 71.4, 64.6, 32.6, 28.5, 20.5, 6.0 

Antibody dilution

1:250 1:500 

Validation WB

Uncertain: No bands detected Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%).  
 

ANTIGEN VIEW

? »
 
 
 
VAV3-001
 
VAV3-005
 
VAV3-007
 
VAV3-202