AP4B1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA028162

 

Antibody HPA028399

 

Antibody HPA028652

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA028162 HPA028399 HPA028652 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

6 6 6 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment 

Length (aa)

92 88 95 

Antigen sequence

VQEYIQQPILNGLRDKASYVRRVAVLGCAKMHNLHGDSEVDGALVNELYS
LLRDQDPIVVVNCLRSLEEILKQEGGVVINKPIAHHLLNRMS
 
DMLGRLLYYCIEEEKDMAVRDRGLFYYRLLLVGIDEVKRILCSPKSDPTL
GLLEDPAERPVNSWASDFNTLVPVYGKAHWATISKCQG
 
LIPEENKERVQELPDSGALMLVPNRQLTADYFEKTWLSLKVAHQQVLPWR
GEFHPDTLQMALQVVNIQTIAMSRAGSRPWKAYLSAQDDTGCLFL
 

Matching transcripts

AP4B1-001 - ENSP00000256658 [100%]
AP4B1-005 - ENSP00000358577 [100%]
AP4B1-007 - ENSP00000358584 [100%]
AP4B1-009 - ENSP00000358582 [100%]
 AP4B1-001 - ENSP00000256658 [100%]
AP4B1-002 - ENSP00000358580 [100%]
AP4B1-009 - ENSP00000358582 [100%]
 AP4B1-001 - ENSP00000256658 [100%]
AP4B1-002 - ENSP00000358580 [100%]
AP4B1-009 - ENSP00000358582 [100%]
 

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic positivity with granular pattern in renal tubules.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:10 1:700 1:15 

Validation IH

Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding dissimilar or partly similar staining patterns and there is no available gene/protein characterization data or only limited gene/protein characterization data 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line A-431 shows positivity in vesicles.
More information
   

Antibody dilution

1:10   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416538)
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416538)
More information
 

Target mass (kDa)

83.3, 33.6, 29.6 83.3, 64.6 83.3, 64.6 

Antibody dilution

1:250 1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:500 1:30000 1:3000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
AP4B1-001
 
AP4B1-002
 
AP4B1-005
 
AP4B1-007
 
AP4B1-009