MST4

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA059921

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA059921 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

75 

Antigen sequence

GHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLV
QTLSCLSMIITPAFAELKQQDENNA
 

Matching transcripts

MST4-001 - ENSP00000377867 [100%]
MST4-003 - ENSP00000419702 [100%]
MST4-004 - ENSP00000418753 [100%]
MST4-005 - ENSP00000377868 [100%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm, centrosome & nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:81 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

49.2, 46.5, 39.7, 37.8 

Antibody dilution

1:270 

Validation WB

Uncertain: No bands detected 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3200 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
MST4-001
 
MST4-003
 
MST4-004
 
MST4-005