CLOCK

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001867

 

Antibody HPA027565

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001867 HPA027565 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 5 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

147 144 

Antigen sequence

RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQL
APINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSG
HSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS
 
TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQ
QQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGN
PSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD
 

Matching transcripts

CLOCK-001 - ENSP00000426983 [100%]
CLOCK-002 - ENSP00000370723 [100%]
CLOCK-005 - ENSP00000308741 [100%]
 CLOCK-001 - ENSP00000426983 [100%]
CLOCK-002 - ENSP00000370723 [100%]
CLOCK-005 - ENSP00000308741 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
More information
 Immunohistochemical staining of human kidney shows moderate nuclear positivity in tubular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:25 1:225 

Validation IH

Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data Uncertain: Two (or more) antibodies yielding partly similar staining patterns which are partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251MG shows positivity in nuclei but not nucleoli.
More information
 Immunofluorescent staining of human cell line U-251MG shows positivity in nucleus but not nucleoli & vesicles.
More information
 

Antibody dilution

1:25 1:100 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

  

Target mass (kDa)

95.3 95.3 

Antibody dilution

1:250 1:250 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:6000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
CLOCK-001
 
CLOCK-002
 
CLOCK-005